Lineage for d4rvjc_ (4rvj C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2067626Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2067627Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2067628Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2068913Protein automated matches [190433] (11 species)
    not a true protein
  7. 2068957Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (25 PDB entries)
  8. 2068982Domain d4rvjc_: 4rvj C: [317062]
    automated match to d4njsa_
    complexed with 478

Details for d4rvjc_

PDB Entry: 4rvj (more details), 1.6 Å

PDB Description: crystal structure of multidrug-resistant clinical isolate a02 hiv-1 protease in complex with amprenavir
PDB Compounds: (C:) hiv-1 protease

SCOPe Domain Sequences for d4rvjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rvjc_ b.50.1.1 (C:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwqrpivtikvggqlkealldtgaddtvledmelpgrwkprmiggiggfvkvrqyd
qipieicghkvigtvlvgptptniigrnlmtqlgctlnf

SCOPe Domain Coordinates for d4rvjc_:

Click to download the PDB-style file with coordinates for d4rvjc_.
(The format of our PDB-style files is described here.)

Timeline for d4rvjc_: