Lineage for d5erra1 (5err A:319-498)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820794Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
    complex fold made of bifurcated and coiled b-sheets
  4. 2820795Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) (S)
    automatically mapped to Pfam PF03453
  5. 2820796Family b.103.1.1: MoeA N-terminal region -like [63883] (3 proteins)
  6. 2820844Protein automated matches [259253] (1 species)
    not a true protein
  7. 2820845Species Norway rat (Rattus norvegicus) [TaxId:10116] [259254] (9 PDB entries)
  8. 2820850Domain d5erra1: 5err A:319-498 [317011]
    Other proteins in same PDB: d5erra2, d5erra3
    automated match to d2ftsa2
    complexed with act, adp, mg, mpd, po4

Details for d5erra1

PDB Entry: 5err (more details), 1.65 Å

PDB Description: gephe in complex with mg(2+) - adp
PDB Compounds: (A:) gephyrin

SCOPe Domain Sequences for d5erra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5erra1 b.103.1.1 (A:319-498) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
spfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgyav
raadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedteliresdd
gteelevrilvqarpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnkf

SCOPe Domain Coordinates for d5erra1:

Click to download the PDB-style file with coordinates for d5erra1.
(The format of our PDB-style files is described here.)

Timeline for d5erra1: