Lineage for d4z07e_ (4z07 E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2816658Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2816902Family b.82.3.0: automated matches [227198] (1 protein)
    not a true family
  6. 2816903Protein automated matches [226927] (20 species)
    not a true protein
  7. 2816931Species Human (Homo sapiens) [TaxId:9606] [256346] (16 PDB entries)
  8. 2816964Domain d4z07e_: 4z07 E: [316460]
    automated match to d5c8wa_
    complexed with ipa, pcg, so4

Details for d4z07e_

PDB Entry: 4z07 (more details), 2.5 Å

PDB Description: co-crystal structure of the tandem cnb (cnb-a/b) domains of human pkg i beta with cgmp
PDB Compounds: (E:) cGMP-dependent protein kinase 1

SCOPe Domain Sequences for d4z07e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z07e_ b.82.3.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shvtlpfypkspqskdlikeaildndfmknlelsqiqeivdcmypveygkdsciikegdv
gslvyvmedgkvevtkegvklctmgpgkvfgelailynctrtatvktlvnvklwaidrqc
fqtimm

SCOPe Domain Coordinates for d4z07e_:

Click to download the PDB-style file with coordinates for d4z07e_.
(The format of our PDB-style files is described here.)

Timeline for d4z07e_: