SCOPe 2.06: Domain d5chqb_: 5chq B:

Lineage for d5chqb_ (5chq B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (42 species)
   not a true protein

7. Species Amphitrite ornata [TaxId:129555] [189339] (9 PDB entries)

8. Domain d5chqb_: 5chq B: [316237]
   automated match to d3ixfa_
   complexed with gol, hem, npo, so4

Details for d5chqb_

PDB Entry: 5chq, 1.87 Å

PDB Description: dehaloperoxidase b in complex with substrate p-nitrophenol

PDB Compounds: (B:) Dehaloperoxidase B

SCOPe Domain Sequences for d5chqb_:

Sequence; same for both SEQRES and ATOM records:

>d5chqb_ a.1.1.2 (B:) automated matches {Amphitrite ornata [TaxId: 129555]}
gfkqdiatlrgdlrtyaqdiflaflnkypdekrnfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdastlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

Timeline for d5chqb_:

• d5chqb_ is new in SCOPe 2.06-stable
  
• d5chqb_ appears in SCOPe 2.07
  
• d5chqb_ appears in the current release, SCOPe 2.08