SCOPe 2.07: Domain d5i82a3: 5i82 A:381-535

Lineage for d5i82a3 (5i82 A:381-535)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.1: Diphtheria toxin, C-terminal domain [49380] (2 families)
   automatically mapped to Pfam PF01324

5. Family b.2.1.0: automated matches [254321] (1 protein)
   not a true family

6. Protein automated matches [254735] (1 species)
   not a true protein

7. Species Corynebacterium diphtheriae [TaxId:1717] [256178] (7 PDB entries)

8. Domain d5i82a3: 5i82 A:381-535 [315146]
   Other proteins in same PDB: d5i82a1, d5i82a2, d5i82b1, d5i82b2, d5i82c1, d5i82c2, d5i82d1, d5i82d2
   automated match to d1f0la1
   complexed with gol, so4; mutant

Details for d5i82a3

PDB Entry: 5i82, 2.35 Å

PDB Description: first crystal structure of e.coli based recombinant diphtheria toxin mutant crm197

PDB Compounds: (A:) diphtheria toxin

SCOPe Domain Sequences for d5i82a3:

Sequence, based on SEQRES records:

>d5i82a3 b.2.1.0 (A:381-535) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk
ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih
sneissdsigvlgyqktvdhtkvnsklslffeiks

Sequence, based on observed residues (ATOM records):

>d5i82a3 b.2.1.0 (A:381-535) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk
ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih
sneissdsigvlgyqkthtkvnsklslffeiks

Timeline for d5i82a3:

• d5i82a3 first appeared in SCOPe 2.06
  
• d5i82a3 appears in the current release, SCOPe 2.08