SCOPe 2.07: Domain d5i82a2: 5i82 A:199-380

Lineage for d5i82a2 (5i82 A:199-380)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.2: Diphtheria toxin, middle domain [56845] (2 families)
   automatically mapped to Pfam PF02764

5. Family f.1.2.0: automated matches [254320] (1 protein)
   not a true family

6. Protein automated matches [254734] (1 species)
   not a true protein

7. Species Corynebacterium diphtheriae [TaxId:1717] [256177] (7 PDB entries)

8. Domain d5i82a2: 5i82 A:199-380 [315145]
   Other proteins in same PDB: d5i82a1, d5i82a3, d5i82b1, d5i82b3, d5i82c1, d5i82c3, d5i82d1, d5i82d3
   automated match to d1ddta3
   complexed with gol, so4; mutant

Details for d5i82a2

PDB Entry: 5i82, 2.35 Å

PDB Description: first crystal structure of e.coli based recombinant diphtheria toxin mutant crm197

PDB Compounds: (A:) diphtheria toxin

SCOPe Domain Sequences for d5i82a2:

Sequence; same for both SEQRES and ATOM records:

>d5i82a2 f.1.2.0 (A:199-380) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
lscinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehp
elselktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiad
gavhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvhnsynrp
ay

Timeline for d5i82a2:

• d5i82a2 first appeared in SCOPe 2.06
  
• d5i82a2 appears in the current release, SCOPe 2.08