Lineage for d5i82b3 (5i82 B:381-535)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2376993Superfamily b.2.1: Diphtheria toxin, C-terminal domain [49380] (2 families) (S)
    automatically mapped to Pfam PF01324
  5. 2377008Family b.2.1.0: automated matches [254321] (1 protein)
    not a true family
  6. 2377009Protein automated matches [254735] (1 species)
    not a true protein
  7. 2377010Species Corynebacterium diphtheriae [TaxId:1717] [256178] (7 PDB entries)
  8. 2377023Domain d5i82b3: 5i82 B:381-535 [314963]
    Other proteins in same PDB: d5i82a1, d5i82a2, d5i82b1, d5i82b2, d5i82c1, d5i82c2, d5i82d1, d5i82d2
    automated match to d1f0la1
    complexed with gol, so4; mutant

Details for d5i82b3

PDB Entry: 5i82 (more details), 2.35 Å

PDB Description: first crystal structure of e.coli based recombinant diphtheria toxin mutant crm197
PDB Compounds: (B:) diphtheria toxin

SCOPe Domain Sequences for d5i82b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i82b3 b.2.1.0 (B:381-535) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk
ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih
sneissdsigvlgyqktvdhtkvnsklslffeiks

SCOPe Domain Coordinates for d5i82b3:

Click to download the PDB-style file with coordinates for d5i82b3.
(The format of our PDB-style files is described here.)

Timeline for d5i82b3: