| Class b: All beta proteins [48724] (178 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.1: Diphtheria toxin, C-terminal domain [49380] (2 families) ![]() automatically mapped to Pfam PF01324 |
| Family b.2.1.0: automated matches [254321] (1 protein) not a true family |
| Protein automated matches [254735] (1 species) not a true protein |
| Species Corynebacterium diphtheriae [TaxId:1717] [256178] (7 PDB entries) |
| Domain d5i82b3: 5i82 B:381-535 [314963] Other proteins in same PDB: d5i82a1, d5i82a2, d5i82b1, d5i82b2, d5i82c1, d5i82c2, d5i82d1, d5i82d2 automated match to d1f0la1 complexed with gol, so4; mutant |
PDB Entry: 5i82 (more details), 2.35 Å
SCOPe Domain Sequences for d5i82b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i82b3 b.2.1.0 (B:381-535) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk
ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih
sneissdsigvlgyqktvdhtkvnsklslffeiks
Timeline for d5i82b3: