Lineage for d5hfka2 (5hfk A:86-207)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998814Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1998815Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1999700Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1999701Protein automated matches [226831] (61 species)
    not a true protein
  7. 1999874Species Escherichia coli K-12 [TaxId:83333] [232348] (2 PDB entries)
  8. 1999875Domain d5hfka2: 5hfk A:86-207 [314721]
    Other proteins in same PDB: d5hfka1, d5hfkb1
    automated match to d3gx0a2
    complexed with gsh

Details for d5hfka2

PDB Entry: 5hfk (more details), 1.55 Å

PDB Description: crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. sakai (ecs3186, target efi-507414) with bound glutathione
PDB Compounds: (A:) Disulfide-bond oxidoreductase YfcG

SCOPe Domain Sequences for d5hfka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hfka2 a.45.1.0 (A:86-207) automated matches {Escherichia coli K-12 [TaxId: 83333]}
flshetreraatlqwlfwqvgglgpmlgqnhhfnhaapqtipyaieryqvetqrlyhvln
krlenspwlggenysiadiacwpwvnawtrqridlamypavknwherirsrpatgqallk
aq

SCOPe Domain Coordinates for d5hfka2:

Click to download the PDB-style file with coordinates for d5hfka2.
(The format of our PDB-style files is described here.)

Timeline for d5hfka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5hfka1