SCOPe 2.06: Domain d5hfkb2: 5hfk B:86-205

Lineage for d5hfkb2 (5hfk B:86-205)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (61 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [314693] (1 PDB entry)

8. Domain d5hfkb2: 5hfk B:86-205 [314694]
   Other proteins in same PDB: d5hfka1, d5hfkb1
   automated match to d3gx0a2

Details for d5hfkb2

PDB Entry: 5hfk, 1.55 Å

PDB Description: crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. sakai (ecs3186, target efi-507414) with bound glutathione

PDB Compounds: (B:) Disulfide-bond oxidoreductase YfcG

SCOPe Domain Sequences for d5hfkb2:

Sequence; same for both SEQRES and ATOM records:

>d5hfkb2 a.45.1.0 (B:86-205) automated matches {Escherichia coli [TaxId: 83333]}
flshetreraatlqwlfwqvgglgpmlgqnhhfnhaapqtipyaieryqvetqrlyhvln
krlenspwlggenysiadiacwpwvnawtrqridlamypavknwherirsrpatgqallk

Timeline for d5hfkb2:

• d5hfkb2 is new in SCOPe 2.06-stable
  
• d5hfkb2 appears in SCOPe 2.07
  
• d5hfkb2 appears in the current release, SCOPe 2.08