SCOPe 2.06: Domain d5f99f_: 5f99 F:

Lineage for d5f99f_ (5f99 F:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein automated matches [193445] (6 species)
   not a true protein

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [225181] (8 PDB entries)

8. Domain d5f99f_: 5f99 F: [314304]
   Other proteins in same PDB: d5f99d_, d5f99h_
   automated match to d1s32f_
   complexed with cl, mg

Details for d5f99f_

PDB Entry: 5f99, 2.63 Å

PDB Description: x-ray structure of the mmtv-a nucleosome core particle

PDB Compounds: (F:) histone h4

SCOPe Domain Sequences for d5f99f_:

Sequence; same for both SEQRES and ATOM records:

>d5f99f_ a.22.1.1 (F:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
gkggakrrrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdav
tytehakrktvtamdvvyalkrqgrtlygfgg

Timeline for d5f99f_:

• d5f99f_ is new in SCOPe 2.06-stable
  
• d5f99f_ appears in SCOPe 2.07
  
• d5f99f_ appears in the current release, SCOPe 2.08