Lineage for d5f99g_ (5f99 G:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987252Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1987253Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1987254Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1987741Protein automated matches [193445] (6 species)
    not a true protein
  7. 1987742Species African clawed frog (Xenopus laevis) [TaxId:8355] [225181] (8 PDB entries)
  8. 1987760Domain d5f99g_: 5f99 G: [314070]
    Other proteins in same PDB: d5f99d_, d5f99h_
    automated match to d1eqza_
    complexed with cl, mg

Details for d5f99g_

PDB Entry: 5f99 (more details), 2.63 Å

PDB Description: x-ray structure of the mmtv-a nucleosome core particle
PDB Compounds: (G:) Histone H2A type 1

SCOPe Domain Sequences for d5f99g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f99g_ a.22.1.1 (G:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
ktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagn
aardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkktessksaks
k

SCOPe Domain Coordinates for d5f99g_:

Click to download the PDB-style file with coordinates for d5f99g_.
(The format of our PDB-style files is described here.)

Timeline for d5f99g_: