Lineage for d5fg9v_ (5fg9 V:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994252Domain d5fg9v_: 5fg9 V: [314184]
    Other proteins in same PDB: d5fg9a_, d5fg9c2, d5fg9e_, d5fg9g_, d5fg9i_, d5fg9j_, d5fg9k_, d5fg9l_, d5fg9n_, d5fg9o_, d5fg9q2, d5fg9s_, d5fg9u_, d5fg9w_, d5fg9x_, d5fg9y_, d5fg9z_
    automated match to d4r17h_
    complexed with mg; mutant

Details for d5fg9v_

PDB Entry: 5fg9 (more details), 2.6 Å

PDB Description: yeast 20s proteasome beta2-t(-2)v mutant
PDB Compounds: (V:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d5fg9v_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fg9v_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tsvgttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavt
qligsnielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihah
gstdvgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvc
vmeigkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee

SCOPe Domain Coordinates for d5fg9v_:

Click to download the PDB-style file with coordinates for d5fg9v_.
(The format of our PDB-style files is described here.)

Timeline for d5fg9v_: