Lineage for d5du0d_ (5du0 D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2184480Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2184481Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2184482Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2184772Protein automated matches [190406] (19 species)
    not a true protein
  7. 2184965Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (54 PDB entries)
  8. 2185044Domain d5du0d_: 5du0 D: [313523]
    automated match to d3st3a_

Details for d5du0d_

PDB Entry: 5du0 (more details), 2.35 Å

PDB Description: crystal structure of rsfolder in the non-fluorescent off-state
PDB Compounds: (D:) Green fluorescent protein

SCOPe Domain Sequences for d5du0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5du0d_ d.22.1.1 (D:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlv
ttlxvlcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvnri
elkgidfkedgnilghkleynfnshnvyitadkqkngiksnfkirhnvedgsvqladhyq
qntpigdgpvllpdnhylstqsklskdpnekrdhmvllefvtaagith

SCOPe Domain Coordinates for d5du0d_:

Click to download the PDB-style file with coordinates for d5du0d_.
(The format of our PDB-style files is described here.)

Timeline for d5du0d_: