Lineage for d5cz5h_ (5cz5 H:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2229707Domain d5cz5h_: 5cz5 H: [313012]
    Other proteins in same PDB: d5cz5a_, d5cz5e_, d5cz5g_, d5cz5i_, d5cz5j_, d5cz5k_, d5cz5l_, d5cz5n_, d5cz5o_, d5cz5s_, d5cz5u_, d5cz5w_, d5cz5x_, d5cz5y_, d5cz5z_
    automated match to d4r17h_
    complexed with 3bv, cl, mes, mg; mutant

Details for d5cz5h_

PDB Entry: 5cz5 (more details), 2.8 Å

PDB Description: yeast 20s proteasome beta1-t1a mutant in complex with carfilzomib
PDB Compounds: (H:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d5cz5h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cz5h_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd

SCOPe Domain Coordinates for d5cz5h_:

Click to download the PDB-style file with coordinates for d5cz5h_.
(The format of our PDB-style files is described here.)

Timeline for d5cz5h_: