Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (11 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries) |
Domain d5cz5p_: 5cz5 P: [312897] Other proteins in same PDB: d5cz5a_, d5cz5e_, d5cz5g_, d5cz5i_, d5cz5j_, d5cz5k_, d5cz5l_, d5cz5n_, d5cz5o_, d5cz5s_, d5cz5u_, d5cz5w_, d5cz5x_, d5cz5y_, d5cz5z_ automated match to d1rypc_ complexed with 3bv, cl, mes, mg; mutant |
PDB Entry: 5cz5 (more details), 2.8 Å
SCOPe Domain Sequences for d5cz5p_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cz5p_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d5cz5p_: