Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) |
Family d.122.1.0: automated matches [227160] (1 protein) not a true family |
Protein automated matches [226867] (22 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [232247] (22 PDB entries) |
Domain d5ctyb_: 5cty B: [312883] automated match to d3u2ka_ protein/DNA complex; complexed with 55h, cl, mg, mpd |
PDB Entry: 5cty (more details), 1.6 Å
SCOPe Domain Sequences for d5ctyb_:
Sequence, based on SEQRES records: (download)
>d5ctyb_ d.122.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]} qvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikv tdngrgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdl kevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenv redsyhyeg
>d5ctyb_ d.122.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]} qvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikv tdngrgipvdiqgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlkev gttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenvred syhyeg
Timeline for d5ctyb_: