Lineage for d5bvra1 (5bvr A:6-120)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712022Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 2712023Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 2712101Family a.40.1.0: automated matches [227151] (1 protein)
    not a true family
  6. 2712102Protein automated matches [226856] (4 species)
    not a true protein
  7. 2712191Species Schizosaccharomyces pombe [TaxId:284812] [312738] (1 PDB entry)
  8. 2712192Domain d5bvra1: 5bvr A:6-120 [312739]
    automated match to d1wkua1
    complexed with zn

Details for d5bvra1

PDB Entry: 5bvr (more details), 1.46 Å

PDB Description: actin binding domain of alpha-actinin from schizosaccharomyces pombe
PDB Compounds: (A:) Alpha-actinin-like protein 1

SCOPe Domain Sequences for d5bvra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bvra1 a.40.1.0 (A:6-120) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
wqsvqnrtftkwfntklssrdlpsvfdlrkdlsdgilliqlleiigdenlgrynrnprmr
vhrlenvnkaleyikskgmpltnigpadivdgnlklilgliwtlilrftiadine

SCOPe Domain Coordinates for d5bvra1:

Click to download the PDB-style file with coordinates for d5bvra1.
(The format of our PDB-style files is described here.)

Timeline for d5bvra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5bvra2