Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.1: Flavodoxin-related [52219] (6 proteins) binds FMN |
Protein Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain [52229] (1 species) |
Species Desulfovibrio gigas [TaxId:879] [52230] (1 PDB entry) |
Domain d1e5da1: 1e5d A:251-402 [31208] Other proteins in same PDB: d1e5da2, d1e5db2 complexed with feo, fmn, oxy |
PDB Entry: 1e5d (more details), 2.5 Å
SCOPe Domain Sequences for d1e5da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]} ptnkvvifydsmwhstekmarvlaesfrdegctvklmwckachhsqimseisdagavivg spthnngilpyvagtlqyikglrpqnkiggafgsfgwsgestkvlaewltgmgfdmpatp vkvknvpthadyeqlktmaqtiaralkaklaa
Timeline for d1e5da1: