SCOPe 2.06: Domain d4xcnk1: 4xcn K:1-106

Lineage for d4xcnk1 (4xcn K:1-106)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (183 PDB entries)

8. Domain d4xcnk1: 4xcn K:1-106 [311932]
   Other proteins in same PDB: d4xcnb2, d4xcnd2, d4xcnf2, d4xcni2, d4xcnk2, d4xcnl2
   automated match to d1dn0a1
   complexed with 44e, gol, po4, unl

Details for d4xcnk1

PDB Entry: 4xcn, 2.9 Å

PDB Description: crystal structure of human 4e10 fab in complex with phosphatidic acid (06:0 pa); 2.9 a resolution

PDB Compounds: (K:) 4E10 Fab light chain

SCOPe Domain Sequences for d4xcnk1:

Sequence; same for both SEQRES and ATOM records:

>d4xcnk1 b.1.1.1 (K:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvev

Timeline for d4xcnk1:

• d4xcnk1 is new in SCOPe 2.06-stable
  
• d4xcnk1 appears in SCOPe 2.07
  
• d4xcnk1 appears in the current release, SCOPe 2.08