Lineage for d4xcnf2 (4xcn F:107-213)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2029210Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)
  8. 2030368Domain d4xcnf2: 4xcn F:107-213 [312028]
    Other proteins in same PDB: d4xcnb1, d4xcnd1, d4xcnf1, d4xcni1, d4xcnk1, d4xcnl1
    automated match to d1dn0a2
    complexed with 44e, gol, po4, unl

Details for d4xcnf2

PDB Entry: 4xcn (more details), 2.9 Å

PDB Description: crystal structure of human 4e10 fab in complex with phosphatidic acid (06:0 pa); 2.9 a resolution
PDB Compounds: (F:) 4E10 Fab light chain

SCOPe Domain Sequences for d4xcnf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xcnf2 b.1.1.2 (F:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d4xcnf2:

Click to download the PDB-style file with coordinates for d4xcnf2.
(The format of our PDB-style files is described here.)

Timeline for d4xcnf2: