Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [311423] (25 PDB entries) |
Domain d4r67w_: 4r67 W: [309411] Other proteins in same PDB: d4r671_, d4r672_, d4r673_, d4r67a_, d4r67b_, d4r67c_, d4r67d_, d4r67e_, d4r67f_, d4r67g_, d4r67j_, d4r67l_, d4r67m_, d4r67n_, d4r67o_, d4r67p_, d4r67q_, d4r67r_, d4r67s_, d4r67t_, d4r67u_, d4r67x_, d4r67z_ automated match to d1irui_ complexed with 3bv |
PDB Entry: 4r67 (more details), 2.89 Å
SCOPe Domain Sequences for d4r67w_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r67w_ d.153.1.4 (W:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ttiagvvykdgivlgadtrategmvvadkncskihfispniyccgagtaadtdmttqlis snlelhslstgrlprvvtanrmlkqmlfryqgyigaalvlggvdvtgphlysiyphgstd klpyvtmgsgslaamavfedkfrpdmeeeeaknlvseaiaagifndlgsgsnidlcvisk nkldflrpytvpnkkgtrlgryrcekgttavltekitple
Timeline for d4r67w_:
View in 3D Domains from other chains: (mouse over for more information) d4r670_, d4r671_, d4r672_, d4r673_, d4r67a_, d4r67b_, d4r67c_, d4r67d_, d4r67e_, d4r67f_, d4r67g_, d4r67h_, d4r67i_, d4r67j_, d4r67k_, d4r67l_, d4r67m_, d4r67n_, d4r67o_, d4r67p_, d4r67q_, d4r67r_, d4r67s_, d4r67t_, d4r67u_, d4r67v_, d4r67x_, d4r67y_, d4r67z_ |