Lineage for d4r67w_ (4r67 W:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2995063Species Human (Homo sapiens) [TaxId:9606] [311423] (25 PDB entries)
  8. 2995145Domain d4r67w_: 4r67 W: [309411]
    Other proteins in same PDB: d4r671_, d4r672_, d4r673_, d4r67a_, d4r67b_, d4r67c_, d4r67d_, d4r67e_, d4r67f_, d4r67g_, d4r67j_, d4r67l_, d4r67m_, d4r67n_, d4r67o_, d4r67p_, d4r67q_, d4r67r_, d4r67s_, d4r67t_, d4r67u_, d4r67x_, d4r67z_
    automated match to d1irui_
    complexed with 3bv

Details for d4r67w_

PDB Entry: 4r67 (more details), 2.89 Å

PDB Description: Human constitutive 20S proteasome in complex with carfilzomib
PDB Compounds: (W:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d4r67w_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r67w_ d.153.1.4 (W:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ttiagvvykdgivlgadtrategmvvadkncskihfispniyccgagtaadtdmttqlis
snlelhslstgrlprvvtanrmlkqmlfryqgyigaalvlggvdvtgphlysiyphgstd
klpyvtmgsgslaamavfedkfrpdmeeeeaknlvseaiaagifndlgsgsnidlcvisk
nkldflrpytvpnkkgtrlgryrcekgttavltekitple

SCOPe Domain Coordinates for d4r67w_:

Click to download the PDB-style file with coordinates for d4r67w_.
(The format of our PDB-style files is described here.)

Timeline for d4r67w_: