Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [311424] (8 PDB entries) |
Domain d4r3oq_: 4r3o Q: [309376] Other proteins in same PDB: d4r3o1_, d4r3o2_, d4r3oa_, d4r3ob_, d4r3oe_, d4r3of_, d4r3og_, d4r3oh_, d4r3oi_, d4r3oj_, d4r3ok_, d4r3ol_, d4r3om_, d4r3on_, d4r3oo_, d4r3op_, d4r3os_, d4r3ot_, d4r3ou_, d4r3ov_, d4r3ow_, d4r3ox_, d4r3oy_, d4r3oz_ automated match to d1rypc_ |
PDB Entry: 4r3o (more details), 2.6 Å
SCOPe Domain Sequences for d4r3oq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r3oq_ d.153.1.0 (Q:) automated matches {Human (Homo sapiens) [TaxId: 9606]} srrydsrttifspegrlyqveyameaighagtclgilandgvllaaerrnihklldevff sekiyklnedmacsvagitsdanvltnelrliaqryllqyqepipceqlvtalcdikqay tqfggkrpfgvsllyigwdkhygfqlyqsdpsgnyggwkatcignnsaaavsmlkqdyke gemtlksalalaikvlnktmdvsklsaekveiatltrengktvirvlkqkeveqlikkhe eeeakaerek
Timeline for d4r3oq_: