Lineage for d4r3op_ (4r3o P:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2224887Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species)
    contains an extension to the common fold at the N-terminus
  7. 2226300Species Human (Homo sapiens) [TaxId:9606] [311422] (8 PDB entries)
  8. 2226335Domain d4r3op_: 4r3o P: [309375]
    Other proteins in same PDB: d4r3o1_, d4r3o2_, d4r3oc_, d4r3oh_, d4r3oi_, d4r3oj_, d4r3ok_, d4r3ol_, d4r3om_, d4r3on_, d4r3oq_, d4r3ov_, d4r3ow_, d4r3ox_, d4r3oy_, d4r3oz_
    automated match to d1irub_

Details for d4r3op_

PDB Entry: 4r3o (more details), 2.6 Å

PDB Description: Human Constitutive 20S Proteasome
PDB Compounds: (P:) Proteasome subunit alpha type-2

SCOPe Domain Sequences for d4r3op_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r3op_ d.153.1.4 (P:) Proteasome alpha subunit (non-catalytic) {Human (Homo sapiens) [TaxId: 9606]}
aergysfslttfspsgklvqieyalaavaggapsvgikaangvvlatekkqksilyders
vhkvepitkhiglvysgmgpdyrvlvhrarklaqqyylvyqepiptaqlvqrvasvmqey
tqsggvrpfgvsllicgwnegrpylfqsdpsgayfawkatamgknyvngktflekryned
leledaihtailtlkesfegqmtednievgicneagfrrltptevkdylaaia

SCOPe Domain Coordinates for d4r3op_:

Click to download the PDB-style file with coordinates for d4r3op_.
(The format of our PDB-style files is described here.)

Timeline for d4r3op_: