Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [311423] (25 PDB entries) |
Domain d4r3oi_: 4r3o I: [309368] Other proteins in same PDB: d4r3o1_, d4r3o2_, d4r3oa_, d4r3ob_, d4r3oc_, d4r3oe_, d4r3of_, d4r3og_, d4r3oj_, d4r3ol_, d4r3om_, d4r3on_, d4r3oo_, d4r3op_, d4r3oq_, d4r3os_, d4r3ot_, d4r3ou_, d4r3ox_, d4r3oz_ automated match to d1irui_ |
PDB Entry: 4r3o (more details), 2.6 Å
SCOPe Domain Sequences for d4r3oi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r3oi_ d.153.1.4 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ttiagvvykdgivlgadtrategmvvadkncskihfispniyccgagtaadtdmttqlis snlelhslstgrlprvvtanrmlkqmlfryqgyigaalvlggvdvtgphlysiyphgstd klpyvtmgsgslaamavfedkfrpdmeeeeaknlvseaiaagifndlgsgsnidlcvisk nkldflrpytvpnkkgtrlgryrcekgttavltekitple
Timeline for d4r3oi_: