Lineage for d4qzwq_ (4qzw Q:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2230570Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2230571Protein automated matches [190509] (14 species)
    not a true protein
  7. 2230621Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries)
  8. 2230747Domain d4qzwq_: 4qzw Q: [309268]
    Other proteins in same PDB: d4qzwa_, d4qzwb_, d4qzwe_, d4qzwf_, d4qzwg_, d4qzwh_, d4qzwi_, d4qzwj_, d4qzwk_, d4qzwl_, d4qzwm_, d4qzwn_, d4qzwo_, d4qzwp_, d4qzws_, d4qzwt_, d4qzwu_, d4qzwv_, d4qzww_, d4qzwx_, d4qzwy_, d4qzwz_
    automated match to d4eu2a_
    complexed with 04c, cl, mes, mg; mutant

Details for d4qzwq_

PDB Entry: 4qzw (more details), 3 Å

PDB Description: yCP beta5-C52F mutant in complex with the epoxyketone inhibitor ONX 0914
PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4qzwq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qzwq_ d.153.1.0 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d4qzwq_:

Click to download the PDB-style file with coordinates for d4qzwq_.
(The format of our PDB-style files is described here.)

Timeline for d4qzwq_: