Lineage for d4eu2a_ (4eu2 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2228679Domain d4eu2a_: 4eu2 A: [196947]
    Other proteins in same PDB: d4eu21_, d4eu22_, d4eu2b_, d4eu2c_, d4eu2d_, d4eu2e_, d4eu2f_, d4eu2g_, d4eu2h_, d4eu2i_, d4eu2j_, d4eu2k_, d4eu2l_, d4eu2m_, d4eu2n_, d4eu2p_, d4eu2q_, d4eu2r_, d4eu2s_, d4eu2t_, d4eu2u_, d4eu2v_, d4eu2w_, d4eu2x_, d4eu2y_, d4eu2z_
    automated match to d1rypa_
    complexed with wpi

Details for d4eu2a_

PDB Entry: 4eu2 (more details), 2.51 Å

PDB Description: Crystal structure of 20s proteasome with novel inhibitor K-7174
PDB Compounds: (A:) Proteasome component C7-alpha

SCOPe Domain Sequences for d4eu2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eu2a_ d.153.1.4 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
e

SCOPe Domain Coordinates for d4eu2a_:

Click to download the PDB-style file with coordinates for d4eu2a_.
(The format of our PDB-style files is described here.)

Timeline for d4eu2a_: