Lineage for d4qw3u_ (4qw3 U:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2224887Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species)
    contains an extension to the common fold at the N-terminus
  7. 2224903Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (193 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2225591Domain d4qw3u_: 4qw3 U: [308683]
    Other proteins in same PDB: d4qw3a_, d4qw3b_, d4qw3c_, d4qw3f_, d4qw3h_, d4qw3i_, d4qw3j_, d4qw3l_, d4qw3m_, d4qw3n_, d4qw3o_, d4qw3p_, d4qw3q_, d4qw3t_, d4qw3v_, d4qw3w_, d4qw3x_, d4qw3z_
    automated match to d1g0ug_
    complexed with bo2, cl, mg; mutant

Details for d4qw3u_

PDB Entry: 4qw3 (more details), 2.9 Å

PDB Description: yCP beta5-C63F mutant in complex with bortezomib
PDB Compounds: (U:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d4qw3u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qw3u_ d.153.1.4 (U:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs
yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq
raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk
idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae
q

SCOPe Domain Coordinates for d4qw3u_:

Click to download the PDB-style file with coordinates for d4qw3u_.
(The format of our PDB-style files is described here.)

Timeline for d4qw3u_: