Lineage for d4qw3f_ (4qw3 F:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2229064Domain d4qw3f_: 4qw3 F: [308669]
    Other proteins in same PDB: d4qw3a_, d4qw3c_, d4qw3e_, d4qw3g_, d4qw3i_, d4qw3j_, d4qw3k_, d4qw3l_, d4qw3n_, d4qw3o_, d4qw3q_, d4qw3s_, d4qw3u_, d4qw3w_, d4qw3x_, d4qw3y_, d4qw3z_
    automated match to d4g4sg_
    complexed with bo2, cl, mg; mutant

Details for d4qw3f_

PDB Entry: 4qw3 (more details), 2.9 Å

PDB Description: yCP beta5-C63F mutant in complex with bortezomib
PDB Compounds: (F:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d4qw3f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qw3f_ d.153.1.4 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d4qw3f_:

Click to download the PDB-style file with coordinates for d4qw3f_.
(The format of our PDB-style files is described here.)

Timeline for d4qw3f_: