Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries) |
Domain d4qvmv_: 4qvm V: [308468] Other proteins in same PDB: d4qvma_, d4qvmc_, d4qvmd_, d4qvme_, d4qvmg_, d4qvmi_, d4qvmj_, d4qvmk_, d4qvml_, d4qvmn_, d4qvmo_, d4qvmq_, d4qvmr_, d4qvms_, d4qvmu_, d4qvmw_, d4qvmx_, d4qvmy_, d4qvmz_ automated match to d4r17h_ complexed with bo2, cl, mg; mutant |
PDB Entry: 4qvm (more details), 2.8 Å
SCOPe Domain Sequences for d4qvmv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qvmv_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee
Timeline for d4qvmv_: