Lineage for d4qvmv_ (4qvm V:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2228934Domain d4qvmv_: 4qvm V: [308468]
    Other proteins in same PDB: d4qvma_, d4qvmc_, d4qvme_, d4qvmg_, d4qvmi_, d4qvmj_, d4qvmk_, d4qvml_, d4qvmn_, d4qvmo_, d4qvmq_, d4qvms_, d4qvmu_, d4qvmw_, d4qvmx_, d4qvmy_, d4qvmz_
    automated match to d4r17h_
    complexed with bo2, cl, mg; mutant

Details for d4qvmv_

PDB Entry: 4qvm (more details), 2.8 Å

PDB Description: yCP beta5-M45A mutant in complex with bortezomib
PDB Compounds: (V:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d4qvmv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qvmv_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee

SCOPe Domain Coordinates for d4qvmv_:

Click to download the PDB-style file with coordinates for d4qvmv_.
(The format of our PDB-style files is described here.)

Timeline for d4qvmv_: