SCOPe 2.07: Domain d4qvmy_: 4qvm Y:

Lineage for d4qvmy_ (4qvm Y:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
   contains an extension to the common fold at the N-terminus

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (242 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d4qvmy_: 4qvm Y: [308471]
   Other proteins in same PDB: d4qvma_, d4qvmb_, d4qvmc_, d4qvmf_, d4qvmh_, d4qvmi_, d4qvmj_, d4qvml_, d4qvmm_, d4qvmn_, d4qvmo_, d4qvmp_, d4qvmq_, d4qvmt_, d4qvmv_, d4qvmw_, d4qvmx_, d4qvmz_
   automated match to d4g4sl_
   complexed with bo2, cl, mg; mutant

Details for d4qvmy_

PDB Entry: 4qvm, 2.8 Å

PDB Description: yCP beta5-M45A mutant in complex with bortezomib

PDB Compounds: (Y:) Proteasome subunit beta type-5

SCOPe Domain Sequences for d4qvmy_:

Sequence; same for both SEQRES and ATOM records:

>d4qvmy_ d.153.1.4 (Y:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtaaggaadcqfwetwlg
sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
tedgwiyhgnhdvgelfwkvkeeegsfnnvig

Timeline for d4qvmy_:

• d4qvmy_ first appeared in SCOPe 2.06
  
• d4qvmy_ appears in the current release, SCOPe 2.08