Lineage for d4qvmq1 (4qvm Q:1-234)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995888Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2995889Protein automated matches [190509] (19 species)
    not a true protein
  7. 2995948Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)
  8. 2996000Domain d4qvmq1: 4qvm Q:1-234 [308464]
    Other proteins in same PDB: d4qvma_, d4qvmb_, d4qvmc2, d4qvmd_, d4qvme_, d4qvmf_, d4qvmg_, d4qvmh_, d4qvmi_, d4qvmj_, d4qvmk_, d4qvml_, d4qvmm_, d4qvmn_, d4qvmo_, d4qvmp_, d4qvmq2, d4qvmr_, d4qvms_, d4qvmt_, d4qvmu_, d4qvmv_, d4qvmw_, d4qvmx_, d4qvmy_, d4qvmz_
    automated match to d4eu2a_
    complexed with bo2, cl, mg; mutant

Details for d4qvmq1

PDB Entry: 4qvm (more details), 2.8 Å

PDB Description: yCP beta5-M45A mutant in complex with bortezomib
PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4qvmq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qvmq1 d.153.1.0 (Q:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

SCOPe Domain Coordinates for d4qvmq1:

Click to download the PDB-style file with coordinates for d4qvmq1.
(The format of our PDB-style files is described here.)

Timeline for d4qvmq1: