Lineage for d4qv9h_ (4qv9 H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2993711Domain d4qv9h_: 4qv9 H: [308407]
    Other proteins in same PDB: d4qv9a_, d4qv9c1, d4qv9c2, d4qv9d_, d4qv9e_, d4qv9g_, d4qv9i_, d4qv9j_, d4qv9k_, d4qv9l_, d4qv9n_, d4qv9o_, d4qv9q1, d4qv9q2, d4qv9r_, d4qv9s_, d4qv9u_, d4qv9w_, d4qv9x_, d4qv9y_, d4qv9z_
    automated match to d4r17h_
    complexed with cl, mg; mutant

Details for d4qv9h_

PDB Entry: 4qv9 (more details), 2.6 Å

PDB Description: yCP beta5-C63F mutant
PDB Compounds: (H:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d4qv9h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qv9h_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee

SCOPe Domain Coordinates for d4qv9h_:

Click to download the PDB-style file with coordinates for d4qv9h_.
(The format of our PDB-style files is described here.)

Timeline for d4qv9h_: