Lineage for d4qv4x_ (4qv4 X:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2597201Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2597210Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2597777Domain d4qv4x_: 4qv4 X: [308302]
    Other proteins in same PDB: d4qv4b_, d4qv4c_, d4qv4d_, d4qv4e_, d4qv4f_, d4qv4g_, d4qv4h_, d4qv4k_, d4qv4m_, d4qv4p_, d4qv4q_, d4qv4r_, d4qv4s_, d4qv4t_, d4qv4u_, d4qv4v_, d4qv4y_
    automated match to d1rypk_
    complexed with cl, mg; mutant

Details for d4qv4x_

PDB Entry: 4qv4 (more details), 2.7 Å

PDB Description: yCP beta5-M45T mutant
PDB Compounds: (X:) Proteasome subunit beta type-4

SCOPe Domain Sequences for d4qv4x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qv4x_ d.153.1.4 (X:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
vkivdkdgirqvddf

SCOPe Domain Coordinates for d4qv4x_:

Click to download the PDB-style file with coordinates for d4qv4x_.
(The format of our PDB-style files is described here.)

Timeline for d4qv4x_: