Lineage for d4qv4c_ (4qv4 C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2602131Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2602132Protein automated matches [190509] (19 species)
    not a true protein
  7. 2602194Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)
  8. 2602223Domain d4qv4c_: 4qv4 C: [308283]
    Other proteins in same PDB: d4qv4a_, d4qv4b_, d4qv4d_, d4qv4e_, d4qv4f_, d4qv4g_, d4qv4h_, d4qv4i_, d4qv4j_, d4qv4k_, d4qv4l_, d4qv4m_, d4qv4n_, d4qv4o_, d4qv4p_, d4qv4r_, d4qv4s_, d4qv4t_, d4qv4u_, d4qv4v_, d4qv4w_, d4qv4x_, d4qv4y_, d4qv4z_
    automated match to d4eu2a_
    complexed with cl, mg; mutant

Details for d4qv4c_

PDB Entry: 4qv4 (more details), 2.7 Å

PDB Description: yCP beta5-M45T mutant
PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4qv4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qv4c_ d.153.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d4qv4c_:

Click to download the PDB-style file with coordinates for d4qv4c_.
(The format of our PDB-style files is described here.)

Timeline for d4qv4c_: