![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
![]() | Protein automated matches [190509] (19 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries) |
![]() | Domain d4qv4c_: 4qv4 C: [308283] Other proteins in same PDB: d4qv4a_, d4qv4b_, d4qv4d_, d4qv4e_, d4qv4f_, d4qv4g_, d4qv4h_, d4qv4i_, d4qv4j_, d4qv4k_, d4qv4l_, d4qv4m_, d4qv4n_, d4qv4o_, d4qv4p_, d4qv4r_, d4qv4s_, d4qv4t_, d4qv4u_, d4qv4v_, d4qv4w_, d4qv4x_, d4qv4y_, d4qv4z_ automated match to d4eu2a_ complexed with cl, mg; mutant |
PDB Entry: 4qv4 (more details), 2.7 Å
SCOPe Domain Sequences for d4qv4c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qv4c_ d.153.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
Timeline for d4qv4c_: