SCOPe 2.07: Domain d4qv4b_: 4qv4 B:

Lineage for d4qv4b_ (4qv4 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)

8. Domain d4qv4b_: 4qv4 B: [308282]
   Other proteins in same PDB: d4qv4a_, d4qv4c_, d4qv4d_, d4qv4e_, d4qv4g_, d4qv4i_, d4qv4j_, d4qv4k_, d4qv4l_, d4qv4n_, d4qv4o_, d4qv4q_, d4qv4r_, d4qv4s_, d4qv4u_, d4qv4w_, d4qv4x_, d4qv4y_, d4qv4z_
   automated match to d1rypc_
   complexed with cl, mg; mutant

Details for d4qv4b_

PDB Entry: 4qv4, 2.7 Å

PDB Description: yCP beta5-M45T mutant

PDB Compounds: (B:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d4qv4b_:

Sequence; same for both SEQRES and ATOM records:

>d4qv4b_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

Timeline for d4qv4b_:

• d4qv4b_ first appeared in SCOPe 2.06
  
• d4qv4b_ appears in the current release, SCOPe 2.08