Lineage for d1h7wd4 (1h7w D:184-287,D:441-532)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 979303Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 979304Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) (S)
    this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains
  5. 979305Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 proteins)
  6. 979318Protein Dihydropyrimidine dehydrogenase, domain 2 [51977] (1 species)
  7. 979319Species Pig (Sus scrofa) [TaxId:9823] [51978] (5 PDB entries)
  8. 979327Domain d1h7wd4: 1h7w D:184-287,D:441-532 [30612]
    Other proteins in same PDB: d1h7wa1, d1h7wa2, d1h7wa3, d1h7wa5, d1h7wb1, d1h7wb2, d1h7wb3, d1h7wb5, d1h7wc1, d1h7wc2, d1h7wc3, d1h7wc5, d1h7wd1, d1h7wd2, d1h7wd3, d1h7wd5
    complexed with fad, fmn, sf4

Details for d1h7wd4

PDB Entry: 1h7w (more details), 1.9 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig
PDB Compounds: (D:) dihydropyrimidine dehydrogenase

SCOPe Domain Sequences for d1h7wd4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h7wd4 c.4.1.1 (D:184-287,D:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]}
eaysakiallgagpasiscasflarlgysditifekqeyvgglstseipqfrlpydvvnf
eielmkdlgvkiicgkslseneitlntlkeegykaafigiglpeXvlrdpkvkealspik
fnrwdlpevdpetmqtsepwvfaggdivgmanttvesvndgkqaswyihkyiqaqygasv
sakpelplfytpvdlvd

SCOPe Domain Coordinates for d1h7wd4:

Click to download the PDB-style file with coordinates for d1h7wd4.
(The format of our PDB-style files is described here.)

Timeline for d1h7wd4: