| Root: SCOPe 2.08 |
| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family) ![]() automatically mapped to Pfam PF01405 |
| Family f.23.34.1: PsbT-like [161030] (2 proteins) Pfam PF01405 |
| Protein Photosystem II reaction center protein T, PsbT [161031] (3 species) |
| Species Thermosynechococcus vulcanus [TaxId:32053] [224949] (24 PDB entries) |
| Domain d3arct_: 3arc T: [305014] Other proteins in same PDB: d3arca_, d3arcb_, d3arcc_, d3arcd_, d3arce_, d3arcf_, d3arch_, d3arci_, d3arcj_, d3arck_, d3arcl_, d3arcm_, d3arco_, d3arcu_, d3arcv_, d3arcx_, d3arcz_ automated match to d2axtt1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 3arc (more details), 1.9 Å
SCOPe Domain Sequences for d3arct_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3arct_ f.23.34.1 (T:) Photosystem II reaction center protein T, PsbT {Thermosynechococcus vulcanus [TaxId: 32053]}
metityvfifaciialfffaiffrepprit
Timeline for d3arct_: