Lineage for d3arct_ (3arc T:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026547Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family) (S)
    automatically mapped to Pfam PF01405
  5. 3026548Family f.23.34.1: PsbT-like [161030] (2 proteins)
    Pfam PF01405
  6. 3026549Protein Photosystem II reaction center protein T, PsbT [161031] (3 species)
  7. 3026564Species Thermosynechococcus vulcanus [TaxId:32053] [224949] (24 PDB entries)
  8. 3026568Domain d3arct_: 3arc T: [305014]
    Other proteins in same PDB: d3arca_, d3arcb_, d3arcc_, d3arcd_, d3arce_, d3arcf_, d3arch_, d3arci_, d3arcj_, d3arck_, d3arcl_, d3arcm_, d3arco_, d3arcu_, d3arcv_, d3arcx_, d3arcz_
    automated match to d2axtt1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d3arct_

PDB Entry: 3arc (more details), 1.9 Å

PDB Description: Crystal structure of oxygen-evolving Photosystem II at 1.9 angstrom resolution
PDB Compounds: (T:) Photosystem II reaction center protein T

SCOPe Domain Sequences for d3arct_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3arct_ f.23.34.1 (T:) Photosystem II reaction center protein T, PsbT {Thermosynechococcus vulcanus [TaxId: 32053]}
metityvfifaciialfffaiffrepprit

SCOPe Domain Coordinates for d3arct_:

Click to download the PDB-style file with coordinates for d3arct_.
(The format of our PDB-style files is described here.)

Timeline for d3arct_: