Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families) automatically mapped to Pfam PF01788 |
Family f.23.32.1: PsbJ-like [161022] (2 proteins) Pfam PF01788 |
Protein Photosystem II reaction center protein J, PsbJ [161023] (2 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [259622] (3 PDB entries) |
Domain d3arcj_: 3arc J: [305009] Other proteins in same PDB: d3arca_, d3arcb_, d3arcc_, d3arcd_, d3arce_, d3arcf_, d3arch_, d3arci_, d3arck_, d3arcl_, d3arcm_, d3arco_, d3arct_, d3arcu_, d3arcv_, d3arcx_, d3arcz_ automated match to d2axtj1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 3arc (more details), 1.9 Å
SCOPe Domain Sequences for d3arcj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3arcj_ f.23.32.1 (J:) Photosystem II reaction center protein J, PsbJ {Thermosynechococcus vulcanus [TaxId: 32053]} seggriplwivatvagmgvivivglffygayaglgssl
Timeline for d3arcj_: