Lineage for d3arck_ (3arc K:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254892Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) (S)
    automatically mapped to Pfam PF02533
  5. 2254893Family f.23.36.1: PsbK-like [161038] (2 proteins)
    Pfam PF02533
  6. 2254894Protein Photosystem II reaction center protein K, PsbK [161039] (2 species)
  7. 2254900Species Thermosynechococcus vulcanus [TaxId:32053] [192450] (10 PDB entries)
  8. 2254903Domain d3arck_: 3arc K: [305010]
    Other proteins in same PDB: d3arca_, d3arcb_, d3arcc_, d3arcd_, d3arce_, d3arcf_, d3arch_, d3arci_, d3arcj_, d3arcl_, d3arcm_, d3arco_, d3arct_, d3arcu_, d3arcv_, d3arcx_, d3arcz_
    automated match to d2axtk1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d3arck_

PDB Entry: 3arc (more details), 1.9 Å

PDB Description: Crystal structure of oxygen-evolving Photosystem II at 1.9 angstrom resolution
PDB Compounds: (K:) Photosystem II reaction center protein K

SCOPe Domain Sequences for d3arck_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3arck_ f.23.36.1 (K:) Photosystem II reaction center protein K, PsbK {Thermosynechococcus vulcanus [TaxId: 32053]}
klpeayaifdplvdvlpvipvlflalafvwqaavgfr

SCOPe Domain Coordinates for d3arck_:

Click to download the PDB-style file with coordinates for d3arck_.
(The format of our PDB-style files is described here.)

Timeline for d3arck_: