Lineage for d3arci_ (3arc I:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254921Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) (S)
    automatically mapped to Pfam PF02532
  5. 2254922Family f.23.37.1: PsbI-like [161042] (1 protein)
    Pfam PF02532
  6. 2254923Protein Photosystem II reaction center protein I, PsbI [161043] (3 species)
  7. 2254934Species Thermosynechococcus vulcanus [TaxId:32053] [224950] (10 PDB entries)
  8. 2254936Domain d3arci_: 3arc I: [305008]
    Other proteins in same PDB: d3arca_, d3arcb_, d3arcc_, d3arcd_, d3arce_, d3arcf_, d3arch_, d3arcj_, d3arck_, d3arcl_, d3arcm_, d3arco_, d3arct_, d3arcu_, d3arcv_, d3arcx_, d3arcz_
    automated match to d2axti1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d3arci_

PDB Entry: 3arc (more details), 1.9 Å

PDB Description: Crystal structure of oxygen-evolving Photosystem II at 1.9 angstrom resolution
PDB Compounds: (I:) Photosystem II reaction center protein I

SCOPe Domain Sequences for d3arci_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3arci_ f.23.37.1 (I:) Photosystem II reaction center protein I, PsbI {Thermosynechococcus vulcanus [TaxId: 32053]}
metlkitvyivvtffvllfvfgflsgdparnpkrkdle

SCOPe Domain Coordinates for d3arci_:

Click to download the PDB-style file with coordinates for d3arci_.
(The format of our PDB-style files is described here.)

Timeline for d3arci_: