Lineage for d2rd0b_ (2rd0 B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3042247Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 3042445Superfamily h.4.21: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 (iSH2) domain-like [310606] (1 family) (S)
    Pfam PF16454
  5. 3042446Family h.4.21.1: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 domain-like [310658] (2 proteins)
  6. 3042450Protein automated matches [310859] (2 species)
    not a true protein
  7. 3042460Species Human (Homo sapiens) [TaxId:9606] [311240] (9 PDB entries)
  8. 3042469Domain d2rd0b_: 2rd0 B: [304457]
    automated match to d2v1yb_

Details for d2rd0b_

PDB Entry: 2rd0 (more details), 3.05 Å

PDB Description: Structure of a human p110alpha/p85alpha complex
PDB Compounds: (B:) Phosphatidylinositol 3-kinase regulatory subunit alpha

SCOPe Domain Sequences for d2rd0b_:

Sequence, based on SEQRES records: (download)

>d2rd0b_ h.4.21.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ieavgkklheyntqfqeksreydrlyeeytrtsqeiqmkrtaieafnetikifeeqcqtq
eryskeyiekfkregnekeiqrimhnydklksriseiidsrrrleedlkkqaaeyreidk
rmnsikpdliqlrktrdqylmwltqkgvrqkklnewlgn

Sequence, based on observed residues (ATOM records): (download)

>d2rd0b_ h.4.21.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ieavgkklheyntqfqeksreydrlyeeytrtsqeiqmkrtaieafnetikifeeqcqtq
eryskeyiiqrimhnydklksriseiidsrrrleedlkkqaaeyreidkrmnsikpdliq
lrktrdqylmwklnewlgn

SCOPe Domain Coordinates for d2rd0b_:

Click to download the PDB-style file with coordinates for d2rd0b_.
(The format of our PDB-style files is described here.)

Timeline for d2rd0b_: