Lineage for d2v1yb_ (2v1y B:)
- Root: SCOPe 2.08
Class h: Coiled coil proteins [57942] (7 folds) 
Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
this is not a true fold; contains at least two very long antiparallel helices
Superfamily h.4.21: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 (iSH2) domain-like [310606] (1 family) 
Pfam PF16454Family h.4.21.1: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 domain-like [310658] (2 proteins) Protein Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 domain [310821] (1 species) Species Human (Homo sapiens) [TaxId:9606] [311088] (1 PDB entry) 
Domain d2v1yb_: 2v1y B: [304492]
Other proteins in same PDB: d2v1ya_
Details for d2v1yb_
PDB Entry: 2v1y (more details), 2.4 Å
PDB Description: structure of a phosphoinositide 3-kinase alpha adaptor-binding domain (abd) in a complex with the ish2 domain from p85 alpha
PDB Compounds: (B:) Phosphatidylinositol 3-kinase regulatory subunit alphaSCOPe Domain Sequences for d2v1yb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v1yb_ h.4.21.1 (B:) Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 domain {Human (Homo sapiens) [TaxId: 9606]}
yqqdqvvkednieavgkklhkyntqfqeksreydrlyeeytrtsqeiqmkrtaieafnet
ikifeeqcqtqeryskeyiekfkregnekeiqrimhnydklksriseiidsrrrleedlk
kqaaeyreidkrmnsikpdliqlrktrdqylmwltqkgvrqkklnewlgn
SCOPe Domain Coordinates for d2v1yb_:
Click to download the PDB-style file with coordinates for d2v1yb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2v1yb_:
- d2v1yb_ first appeared in SCOPe 2.06
- d2v1yb_ appears in SCOPe 2.07
View in 3D
