SCOPe 2.08: Domain d2pz3a1: 2pz3 A:5-60,A:182-345

Lineage for d2pz3a1 (2pz3 A:5-60,A:182-345)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (4 species)
   common fold is interrupted with an all-alpha domain

7. Species Human (Homo sapiens) [TaxId:9606] [159560] (9 PDB entries)

8. Domain d2pz3a1: 2pz3 A:5-60,A:182-345 [304386]
   Other proteins in same PDB: d2pz3a2
   automated match to d3umsa2
   complexed with alf, gdp, mg; mutant
   has additional subdomain(s) that are not in the common domain

Details for d2pz3a1

PDB Entry: 2pz3, 2.42 Å

PDB Description: Crystal structure of the AMF-bound conformation of a G-alpha-i1 mutant with enhanced GTPase activity

PDB Compounds: (A:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOPe Domain Sequences for d2pz3a1:

Sequence; same for both SEQRES and ATOM records:

>d2pz3a1 c.37.1.8 (A:5-60,A:182-345) Transducin (alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
lsaedkaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagXtgi
vethftfkdlhfkmfdvagqrserkkwihcfegvtaiifcvalsdydlvlaedeemnrmh
esmklfdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaayiq
cqfedlnkrkdtkeiythftcatdtknvqfvfdavtdviik

Timeline for d2pz3a1:

• d2pz3a1 first appeared in SCOPe 2.06
  
• d2pz3a1 appears in SCOPe 2.07