Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Transducin (alpha subunit) [52623] (4 species) common fold is interrupted with an all-alpha domain |
Species Human (Homo sapiens) [TaxId:9606] [159560] (9 PDB entries) |
Domain d2pz3a1: 2pz3 A:5-60,A:182-345 [304386] Other proteins in same PDB: d2pz3a2 automated match to d3umsa2 complexed with alf, gdp, mg; mutant has additional subdomain(s) that are not in the common domain |
PDB Entry: 2pz3 (more details), 2.42 Å
SCOPe Domain Sequences for d2pz3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pz3a1 c.37.1.8 (A:5-60,A:182-345) Transducin (alpha subunit) {Human (Homo sapiens) [TaxId: 9606]} lsaedkaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagXtgi vethftfkdlhfkmfdvagqrserkkwihcfegvtaiifcvalsdydlvlaedeemnrmh esmklfdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaayiq cqfedlnkrkdtkeiythftcatdtknvqfvfdavtdviik
Timeline for d2pz3a1: