Lineage for d2jp3a_ (2jp3 A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026929Superfamily f.23.43: ATP1G1/PLM/MAT8-like (FXYD-like) [310576] (1 family) (S)
    Pfam PF02038
  5. 3026930Family f.23.43.1: ATP1G1/PLM/MAT8-like (FXYD-like) [310614] (5 proteins)
  6. 3026951Protein Sodium/potassium-transporting ATPase regulatory protein FXYD4 (CHIF) [310700] (1 species)
  7. 3026952Species Human (Homo sapiens) [TaxId:9606] [310922] (1 PDB entry)
  8. 3026953Domain d2jp3a_: 2jp3 A: [304145]

Details for d2jp3a_

PDB Entry: 2jp3 (more details)

PDB Description: solution structure of the human fxyd4 (chif) protein in sds micelles
PDB Compounds: (A:) FXYD domain-containing ion transport regulator 4

SCOPe Domain Sequences for d2jp3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jp3a_ f.23.43.1 (A:) Sodium/potassium-transporting ATPase regulatory protein FXYD4 (CHIF) {Human (Homo sapiens) [TaxId: 9606]}
ngpvdkgspfyydweslqlgglifggllciagialalsgkckcrrnhtpsslpekvtpli
tpgsast

SCOPe Domain Coordinates for d2jp3a_:

Click to download the PDB-style file with coordinates for d2jp3a_.
(The format of our PDB-style files is described here.)

Timeline for d2jp3a_: