Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.43: ATP1G1/PLM/MAT8-like (FXYD-like) [310576] (1 family) Pfam PF02038 |
Family f.23.43.1: ATP1G1/PLM/MAT8-like (FXYD-like) [310614] (5 proteins) |
Protein Sodium/potassium-transporting ATPase regulatory protein FXYD4 (CHIF) [310700] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [310922] (1 PDB entry) |
Domain d2jp3a_: 2jp3 A: [304145] |
PDB Entry: 2jp3 (more details)
SCOPe Domain Sequences for d2jp3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jp3a_ f.23.43.1 (A:) Sodium/potassium-transporting ATPase regulatory protein FXYD4 (CHIF) {Human (Homo sapiens) [TaxId: 9606]} ngpvdkgspfyydweslqlgglifggllciagialalsgkckcrrnhtpsslpekvtpli tpgsast
Timeline for d2jp3a_: