PDB entry 2jp3

View 2jp3 on RCSB PDB site
Description: Solution Structure of the human FXYD4 (CHIF) protein in SDS micelles
Class: transcription
Keywords: Protein, TRANSCRIPTION
Deposited on 2007-04-18, released 2008-03-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: FXYD domain-containing ion transport regulator 4
  Species: Rattus norvegicus [TaxId:10116]
  Gene: Fxyd4
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q63113 (0-66)
    • conflict (21)
    • conflict (34)
  Domains in SCOPe 2.08: d2jp3a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jp3A (A:)
  ngpvdkgspfyydweslqlgglifggllciagialalsgkckcrrnhtpsslpekvtpli
  tpgsast