Lineage for d1fohc5 (1foh C:1-240,C:342-461)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 309374Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 309375Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 309426Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (11 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 309516Protein Phenol hydroxylase [51922] (1 species)
    structurally very similar to PHBH, but contains additional C-terminal domain of the thioredoxin-like fold
  7. 309517Species Soil-living yeast (Trichosporon cutaneum) [TaxId:5554] [51923] (1 PDB entry)
  8. 309520Domain d1fohc5: 1foh C:1-240,C:342-461 [30383]
    Other proteins in same PDB: d1foha3, d1foha4, d1fohb3, d1fohb4, d1fohc3, d1fohc4, d1fohd3, d1fohd4

Details for d1fohc5

PDB Entry: 1foh (more details), 2.4 Å

PDB Description: phenol hydroxylase from trichosporon cutaneum

SCOP Domain Sequences for d1fohc5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fohc5 c.3.1.2 (C:1-240,C:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum)}
tkysesycdvlivgagpaglmaarvlseyvrqkpdlkvriidkrstkvyngqadglqcrt
leslknlgladkilseandmstialynpdenghirrtdripdtlpgisryhqvvlhqgri
erhildsiaeisdtrikverplipekmeidsskaedpeaypvtmtlrymsdhestplqfg
hktenslfhsnlqtqeeedanyrlpegkeageietvhckyvigcdgghswvrrtlgfemi
Xvtekfskdervfiagdachthspkagqgmntsmmdtynlgwklglvltgrakrdilkty
eeerhafaqalidfdhqfsrlfsgrpakdvademgvsmdvfkeafvkgnefasgtainyd
e

SCOP Domain Coordinates for d1fohc5:

Click to download the PDB-style file with coordinates for d1fohc5.
(The format of our PDB-style files is described here.)

Timeline for d1fohc5: