Class b: All beta proteins [48724] (178 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
Protein automated matches [226946] (29 species) not a true protein |
Species Methanococcus maripaludis [TaxId:39152] [311184] (2 PDB entries) |
Domain d1wb2d5: 1wb2 D:180-271 [303291] Other proteins in same PDB: d1wb2a5, d1wb2a7, d1wb2a9, d1wb2b4, d1wb2b6, d1wb2c5, d1wb2c7, d1wb2c9, d1wb2d4, d1wb2d6 automated match to d4ac9a1 complexed with dxc, so4 |
PDB Entry: 1wb2 (more details), 3.1 Å
SCOPe Domain Sequences for d1wb2d5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wb2d5 b.43.3.0 (D:180-271) automated matches {Methanococcus maripaludis [TaxId: 39152]} rntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinmstkvrsiqyfkesv meakagdrvgmaiqgvdakqiyrgciltskdt
Timeline for d1wb2d5: