Lineage for d1wb2c6 (1wb2 C:180-271)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2402482Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2402557Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2402871Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 2402872Protein automated matches [226946] (29 species)
    not a true protein
  7. 2402941Species Methanococcus maripaludis [TaxId:39152] [311184] (2 PDB entries)
  8. 2402951Domain d1wb2c6: 1wb2 C:180-271 [303286]
    Other proteins in same PDB: d1wb2a5, d1wb2a7, d1wb2a9, d1wb2b4, d1wb2b6, d1wb2c5, d1wb2c7, d1wb2c9, d1wb2d4, d1wb2d6
    automated match to d4ac9a1
    complexed with dxc, so4

Details for d1wb2c6

PDB Entry: 1wb2 (more details), 3.1 Å

PDB Description: Crystal structure of translation elongation factor SelB from Methanococcus maripaludis, apo form
PDB Compounds: (C:) translation elongation factor selb

SCOPe Domain Sequences for d1wb2c6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wb2c6 b.43.3.0 (C:180-271) automated matches {Methanococcus maripaludis [TaxId: 39152]}
rntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinmstkvrsiqyfkesv
meakagdrvgmaiqgvdakqiyrgciltskdt

SCOPe Domain Coordinates for d1wb2c6:

Click to download the PDB-style file with coordinates for d1wb2c6.
(The format of our PDB-style files is described here.)

Timeline for d1wb2c6: