SCOPe 2.06: Domain d1l7sl4: 1l7s L:113-219

Lineage for d1l7sl4 (1l7s L:113-219)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (358 PDB entries)
   Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region

8. Domain d1l7sl4: 1l7s L:113-219 [302659]
   Other proteins in same PDB: d1l7sh3, d1l7sh4, d1l7sl3
   automated match to d1l7tl2
   complexed with tes

Details for d1l7sl4

PDB Entry: 1l7s, 2.15 Å

PDB Description: Crystal Structure Analysis of the Anti-testosterone Fab in Complex with Testosterone

PDB Compounds: (L:) anti-testosterone (light chain)

SCOPe Domain Sequences for d1l7sl4:

Sequence; same for both SEQRES and ATOM records:

>d1l7sl4 b.1.1.2 (L:113-219) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrdec

Timeline for d1l7sl4:

• d1l7sl4 is new in SCOPe 2.06-stable
  
• d1l7sl4 appears in SCOPe 2.07
  
• d1l7sl4 appears in the current release, SCOPe 2.08